ruben35 ruben35

Today at 8:18 AM
Mathematics

Answered

PLEASE HELP WILL MARK BRAINLIEST ‼️‼️‼️‼️‼️‼️

PLEASE HELP WILL MARK BRAINLIEST ‼️‼️‼️‼️‼️‼️ class=

Answer :

oddoaxel oddoaxel

Today at 8:23 AM

its D.

Step-by-step explanation:

Answer Link

Studying1875 Studying1875

Today at 8:23 AM

Answer: The answer is D. 14

Step-by-step explanation: The square root of 64 is 8 and the square root of 36 is 6. 8+6 = 14.

Answer Link

Other Questions

which answer is right Which graph represents a proportional relationship?

A line has a slope of -3 and passes through the point (-3, 8). What is the equation of the line? o y=-3x+6 o y--3x+8 o y=bx- o y=8x-3

why is winter the gayest of our seasons?

I WILL GIVE CROWNWhich answer best describes the purpose of an intensive pronoun?It describes an action or state of being.It shows that a noun is doing or recei

How do I find the scale factor and find the unknown lengths help please

СРОЧНО Укажите правильный вариант для продолжения фразы: «Ди

How do youdo?I just came to tell youTo tell Lesley (will you:)That her little bluebirdWanted me to bring wordThat the north wind last nightThat made the stars b

Dispute being democratically elected the government of Zimbabwe cannot be called a true democracy?write any 5 reasons to justify your statement

i find very strange that meena has not been promoted that

Select the best answer for the question.12. If you have budg

Solve for y 2y + 6 = 1 - 3y

Show your work for x+3=12

what does Por favor, habla mas despacio mean

Domingo Corporation uses the weighted-average method in its process costing system. This month, the beginning inventory in the first processing department consi

) Case Study: Nancy, a 28 year-old marketing analyst in Minneapolis, has a fear of bridges. She takes a very long route to get to work (and to clients) in order

The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the protein

Many plants are poisonous because their stems and leaves contain oxalic acid, H2C2O4, or sodium oxalate, Na2C2O4. When ingested, these substances cause swelling

A 10-cm-thick aluminum plate (α = 97.1 × 10−6 m2/s) is being heated in liquid with temperature of 550°C. The aluminum plate has a uniform initial temperature of

p Marine International manufactures an aquarium pump and is trying to decide whether to produce the filter system in-house or sign an outsourcing contract with

A television set can be purchased with a $200 down payment plus a $39.99 monthly payment. Alternatively, the television can be purchased with no money down and